![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily) multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer |
![]() | Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) ![]() basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat |
![]() | Family a.204.1.2: MazG-like [116993] (4 proteins) Pfam PF03819 |
![]() | Protein XTP3-transactivated gene A protein homolog RS21-C6 [140792] (1 species) confirmed prediction of the m5dCTPase activity |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [140793] (4 PDB entries) Uniprot Q9QY93 22-134 |
![]() | Domain d2a3qa1: 2a3q A:22-134 [126092] |
PDB Entry: 2a3q (more details), 2.32 Å
SCOPe Domain Sequences for d2a3qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a3qa1 a.204.1.2 (A:22-134) XTP3-transactivated gene A protein homolog RS21-C6 {Mouse (Mus musculus) [TaxId: 10090]} pfrfspeptledirrlhaefaaerdweqfhqprnlllalvgevgelaelfqwksdtepgp qawppkeraalqeelsdvliylvalaarchvdlpqaviskmdtnrqrypvhls
Timeline for d2a3qa1: