SCOPe 2.08: Domain d2a3qb1: 2a3q B:22-130

Lineage for d2a3qb1 (2a3q B:22-130)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
   multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer

4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families)
   basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat

5. Family a.204.1.2: MazG-like [116993] (4 proteins)
   Pfam PF03819

6. Protein XTP3-transactivated gene A protein homolog RS21-C6 [140792] (1 species)
   confirmed prediction of the m5dCTPase activity

7. Species Mouse (Mus musculus) [TaxId:10090] [140793] (4 PDB entries)
   Uniprot Q9QY93 22-134

8. Domain d2a3qb1: 2a3q B:22-130 [126093]

Details for d2a3qb1

PDB Entry: 2a3q, 2.32 Å

PDB Description: x-ray structure of protein from mus musculus mm.29898

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2a3qb1:

Sequence; same for both SEQRES and ATOM records:

>d2a3qb1 a.204.1.2 (B:22-130) XTP3-transactivated gene A protein homolog RS21-C6 {Mouse (Mus musculus) [TaxId: 10090]}
pfrfspeptledirrlhaefaaerdweqfhqprnlllalvgevgelaelfqwksdtepgp
qawppkeraalqeelsdvliylvalaarchvdlpqaviskmdtnrqryp

Timeline for d2a3qb1:

• d2a3qb1 first appeared in SCOP 1.73
  
• d2a3qb1 appears in SCOPe 2.07