SCOPe 2.01: Domain d1z9ha1: 1z9h A:213-373

Lineage for d1z9ha1 (1z9h A:213-373)

Root: SCOPe 2.01
Class a: All alpha proteins [46456] (284 folds)
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
Protein Microsomal prostaglandin E synthase-2 [140556] (1 species)
Species Crab-eating macaque (Macaca fascicularis) [TaxId:9541] [140557] (2 PDB entries)
Uniprot Q9N0A4 213-373
Domain d1z9ha1: 1z9h A:213-373 [124758]
Other proteins in same PDB: d1z9ha2, d1z9hb2, d1z9hc2, d1z9hd2
complexed with act, cl, imn

Details for d1z9ha1

PDB Entry: 1z9h (more details), 2.6 Å

PDB Description: microsomal prostaglandin e synthase type-2

PDB Compounds: (A:) membrane-associated prostaglandin E synthase-2

SCOPe Domain Sequences for d1z9ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]}
lnekeaqqvysgkearteemkwrqwaddwlvhlispnvyrtptealasfdyivregkfga
vegavakymgaaamyliskrlksrhrlqdnvredlyeaadkwvaavgkdrpfmggqkpnl
adlavygvlrvmegldafddlmqhthiqpwylrveraitea

SCOPe Domain Coordinates for d1z9ha1:

Click to download the PDB-style file with coordinates for d1z9ha1.
(The format of our PDB-style files is described here.)

Timeline for d1z9ha1: