Lineage for d1z9ha1 (1z9h A:213-373)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1996614Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains)
  6. 1997169Protein Microsomal prostaglandin E synthase-2 [140556] (1 species)
  7. 1997170Species Crab-eating macaque (Macaca fascicularis) [TaxId:9541] [140557] (2 PDB entries)
    Uniprot Q9N0A4 213-373
  8. 1997171Domain d1z9ha1: 1z9h A:213-373 [124758]
    Other proteins in same PDB: d1z9ha2, d1z9hb2, d1z9hc2, d1z9hd2
    complexed with act, cl, imn

Details for d1z9ha1

PDB Entry: 1z9h (more details), 2.6 Å

PDB Description: Microsomal prostaglandin E synthase type-2
PDB Compounds: (A:) membrane-associated prostaglandin E synthase-2

SCOPe Domain Sequences for d1z9ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]}
lnekeaqqvysgkearteemkwrqwaddwlvhlispnvyrtptealasfdyivregkfga
vegavakymgaaamyliskrlksrhrlqdnvredlyeaadkwvaavgkdrpfmggqkpnl
adlavygvlrvmegldafddlmqhthiqpwylrveraitea

SCOPe Domain Coordinates for d1z9ha1:

Click to download the PDB-style file with coordinates for d1z9ha1.
(The format of our PDB-style files is described here.)

Timeline for d1z9ha1: