Lineage for d1z09a_ (1z09 A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.110: Profilin-like [55769] (10 superfamilies)
core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) 
alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helicesFamily d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
Pfam PF03259
Protein Dynein light chain 2A, cytoplasmic [118074] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [118075] (3 PDB entries)
Uniprot Q9NP97
Domain d1z09a_: 1z09 A: [145950]
automated match to d1z09a1
Details for d1z09a_
PDB Entry: 1z09 (more details)
PDB Description: solution structure of km23
PDB Compounds: (A:) Dynein light chain 2A, cytoplasmicSCOPe Domain Sequences for d1z09a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z09a_ d.110.7.1 (A:) Dynein light chain 2A, cytoplasmic {Human (Homo sapiens) [TaxId: 9606]}
maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdi
dpqndltflrirskkneimvapdkdyfliviqnpte
SCOPe Domain Coordinates for d1z09a_:
Click to download the PDB-style file with coordinates for d1z09a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1z09a_:
- d1z09a_ first appeared in SCOP 1.75, called d1z09a1
- d1z09a_ appears in SCOPe 2.07
View in 3D
