Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices |
Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins) Pfam PF03259 |
Protein Dynein light chain 2A, cytoplasmic [118074] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [118075] (3 PDB entries) Uniprot Q9NP97 |
Domain d1z09a_: 1z09 A: [145950] automated match to d1z09a1 |
PDB Entry: 1z09 (more details)
SCOPe Domain Sequences for d1z09a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z09a_ d.110.7.1 (A:) Dynein light chain 2A, cytoplasmic {Human (Homo sapiens) [TaxId: 9606]} maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdi dpqndltflrirskkneimvapdkdyfliviqnpte
Timeline for d1z09a_: