PDB entry 1z09

View 1z09 on RCSB PDB site
Description: Solution structure of km23
Class: Transport Protein
Keywords: homodimer, protein-protein complex, km23, LC7, dynein light chain, Transport Protein
Deposited on 2005-03-01, released 2005-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain 2A, cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: DNCL2A, BITH, DNLC2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z09a_
  • Chain 'B':
    Compound: Dynein light chain 2A, cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: DNCL2A, BITH, DNLC2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z09b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z09A (A:)
    maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdi
    dpqndltflrirskkneimvapdkdyfliviqnpte
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z09B (B:)
    maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdi
    dpqndltflrirskkneimvapdkdyfliviqnpte