Lineage for d1yvwa1 (1yvw A:4-95)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736411Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
    multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer
  4. 2736412Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) (S)
    basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat
  5. 2736467Family a.204.1.4: HisE-like (PRA-PH) [140797] (1 protein)
    Pfam PF01503
  6. 2736468Protein Phosphoribosyl-ATP pyrophosphatase HisE [140798] (5 species)
  7. 2736469Species Bacillus cereus [TaxId:1396] [140802] (1 PDB entry)
    Uniprot Q81G00 4-95
  8. 2736470Domain d1yvwa1: 1yvw A:4-95 [124122]

Details for d1yvwa1

PDB Entry: 1yvw (more details), 2.6 Å

PDB Description: Crystal structure of Phosphoribosyl-ATP pyrophosphohydrolase from Bacillus cereus. NESGC target BcR13.
PDB Compounds: (A:) Phosphoribosyl-ATP pyrophosphatase

SCOPe Domain Sequences for d1yvwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvwa1 a.204.1.4 (A:4-95) Phosphoribosyl-ATP pyrophosphatase HisE {Bacillus cereus [TaxId: 1396]}
afkllyktieerkgsplpesytnylfskgedkilkkigeecaeviiacknndkeevvkem
vdvfyhcfvllaeknialedvmrevkerngkl

SCOPe Domain Coordinates for d1yvwa1:

Click to download the PDB-style file with coordinates for d1yvwa1.
(The format of our PDB-style files is described here.)

Timeline for d1yvwa1: