![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily) multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer |
![]() | Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) ![]() basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat |
![]() | Family a.204.1.4: HisE-like (PRA-PH) [140797] (1 protein) Pfam PF01503 |
![]() | Protein Phosphoribosyl-ATP pyrophosphatase HisE [140798] (5 species) |
![]() | Species Bacillus cereus [TaxId:1396] [140802] (1 PDB entry) Uniprot Q81G00 4-95 |
![]() | Domain d1yvwa1: 1yvw A:4-95 [124122] |
PDB Entry: 1yvw (more details), 2.6 Å
SCOPe Domain Sequences for d1yvwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yvwa1 a.204.1.4 (A:4-95) Phosphoribosyl-ATP pyrophosphatase HisE {Bacillus cereus [TaxId: 1396]} afkllyktieerkgsplpesytnylfskgedkilkkigeecaeviiacknndkeevvkem vdvfyhcfvllaeknialedvmrevkerngkl
Timeline for d1yvwa1: