PDB entry 1yvw

View 1yvw on RCSB PDB site
Description: Crystal structure of Phosphoribosyl-ATP pyrophosphohydrolase from Bacillus cereus. NESGC target BcR13.
Class: hydrolase
Keywords: HELIX BUNDLE, HISTIDINE BIOSYNTHESIS, pyrophosphatase, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, HYDROLASE
Deposited on 2005-02-16, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.244
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoribosyl-ATP pyrophosphatase
    Species: Bacillus cereus [TaxId:1396]
    Gene: hisE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81G00
      • modified residue (62)
      • modified residue (84)
    Domains in SCOPe 2.07: d1yvwa1
  • Chain 'B':
    Compound: Phosphoribosyl-ATP pyrophosphatase
    Species: Bacillus cereus [TaxId:1396]
    Gene: hisE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81G00
      • modified residue (62)
      • modified residue (84)
    Domains in SCOPe 2.07: d1yvwb_
  • Chain 'C':
    Compound: Phosphoribosyl-ATP pyrophosphatase
    Species: Bacillus cereus [TaxId:1396]
    Gene: hisE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81G00
      • modified residue (62)
      • modified residue (84)
    Domains in SCOPe 2.07: d1yvwc_
  • Chain 'D':
    Compound: Phosphoribosyl-ATP pyrophosphatase
    Species: Bacillus cereus [TaxId:1396]
    Gene: hisE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81G00
      • modified residue (62)
      • modified residue (84)
    Domains in SCOPe 2.07: d1yvwd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yvwA (A:)
    menafkllyktieerkgsplpesytnylfskgedkilkkigeecaeviiacknndkeevv
    kemvdvfyhcfvllaeknialedvmrevkerngklsrvgdrreidtllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yvwA (A:)
    afkllyktieerkgsplpesytnylfskgedkilkkigeecaeviiacknndkeevvkem
    vdvfyhcfvllaeknialedvmrevkerngkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yvwB (B:)
    menafkllyktieerkgsplpesytnylfskgedkilkkigeecaeviiacknndkeevv
    kemvdvfyhcfvllaeknialedvmrevkerngklsrvgdrreidtllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yvwB (B:)
    afkllyktieerkgsplpesytnylfskgedkilkkigeecaeviiacknndkeevvkem
    vdvfyhcfvllaeknialedvmrevkerngkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yvwC (C:)
    menafkllyktieerkgsplpesytnylfskgedkilkkigeecaeviiacknndkeevv
    kemvdvfyhcfvllaeknialedvmrevkerngklsrvgdrreidtllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yvwC (C:)
    afkllyktieerkgsplpesytnylfskgedkilkkigeecaeviiacknndkeevvkem
    vdvfyhcfvllaeknialedvmrevkerngkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yvwD (D:)
    menafkllyktieerkgsplpesytnylfskgedkilkkigeecaeviiacknndkeevv
    kemvdvfyhcfvllaeknialedvmrevkerngklsrvgdrreidtllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yvwD (D:)
    afkllyktieerkgsplpesytnylfskgedkilkkigeecaeviiacknndkeevvkem
    vdvfyhcfvllaeknialedvmrevkerngkl