SCOPe 2.08: Domain d1yvka1: 1yvk A:5-155

Lineage for d1yvka1 (1yvk A:5-155)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
3 layers: a/b/a; contains mixed beta-sheet
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)
Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
Protein Hypothetical protein YvbK (BSu33890) [143706] (1 species)
Species Bacillus subtilis [TaxId:1423] [143707] (1 PDB entry)
Uniprot O32248 5-156
Domain d1yvka1: 1yvk A:5-155 [124101]
Other proteins in same PDB: d1yvka2, d1yvkb3, d1yvkc3, d1yvkd3
complexed with coa

Details for d1yvka1

PDB Entry: 1yvk (more details), 3.01 Å

PDB Description: crystal structure of the bacillis subtilis acetyltransferase in complex with coa, northeast structural genomics target sr237.

PDB Compounds: (A:) hypothetical protein BSU33890

SCOPe Domain Sequences for d1yvka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvka1 d.108.1.1 (A:5-155) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]}
klrielgeetndelydlllladpskdivdeylergecytawagdelagvyvllktrpqtv
eivniavkeslqkkgfgkqlvldaiekakklgadtieigtgnssihqlslyqkcgfriqa
idhdfflrhydedifengiqcrdmvrlyldl

SCOPe Domain Coordinates for d1yvka1:

Click to download the PDB-style file with coordinates for d1yvka1.
(The format of our PDB-style files is described here.)

Timeline for d1yvka1: