PDB entry 1yvk

View 1yvk on RCSB PDB site
Description: Crystal Structure of the Bacillis subtilis Acetyltransferase in complex with CoA, Northeast Structural Genomics Target SR237.
Class: transferase
Keywords: alphs-beta protein, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, TRANSFERASE
Deposited on 2005-02-15, released 2005-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein BSU33890
    Species: Bacillus subtilis [TaxId:224308]
    Gene: yvbK
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32248 (Start-154)
      • modified residue (147)
      • expression tag (155)
    Domains in SCOPe 2.07: d1yvka1, d1yvka2
  • Chain 'B':
    Compound: hypothetical protein BSU33890
    Species: Bacillus subtilis [TaxId:224308]
    Gene: yvbK
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32248 (Start-154)
      • modified residue (147)
      • expression tag (155)
    Domains in SCOPe 2.07: d1yvkb2, d1yvkb3
  • Chain 'C':
    Compound: hypothetical protein BSU33890
    Species: Bacillus subtilis [TaxId:224308]
    Gene: yvbK
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32248 (Start-154)
      • modified residue (147)
      • expression tag (155)
    Domains in SCOPe 2.07: d1yvkc2, d1yvkc3
  • Chain 'D':
    Compound: hypothetical protein BSU33890
    Species: Bacillus subtilis [TaxId:224308]
    Gene: yvbK
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32248 (Start-154)
      • modified residue (147)
      • expression tag (155)
    Domains in SCOPe 2.07: d1yvkd2, d1yvkd3
  • Heterogens: COA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yvkA (A:)
    mnmqklrielgeetndelydlllladpskdivdeylergecytawagdelagvyvllktr
    pqtveivniavkeslqkkgfgkqlvldaiekakklgadtieigtgnssihqlslyqkcgf
    riqaidhdfflrhydedifengiqcrdmvrlyldllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yvkA (A:)
    klrielgeetndelydlllladpskdivdeylergecytawagdelagvyvllktrpqtv
    eivniavkeslqkkgfgkqlvldaiekakklgadtieigtgnssihqlslyqkcgfriqa
    idhdfflrhydedifengiqcrdmvrlyldll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yvkB (B:)
    mnmqklrielgeetndelydlllladpskdivdeylergecytawagdelagvyvllktr
    pqtveivniavkeslqkkgfgkqlvldaiekakklgadtieigtgnssihqlslyqkcgf
    riqaidhdfflrhydedifengiqcrdmvrlyldllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yvkB (B:)
    klrielgeetndelydlllladpskdivdeylergecytawagdelagvyvllktrpqtv
    eivniavkeslqkkgfgkqlvldaiekakklgadtieigtgnssihqlslyqkcgfriqa
    idhdfflrhydedifengiqcrdmvrlyldll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yvkC (C:)
    mnmqklrielgeetndelydlllladpskdivdeylergecytawagdelagvyvllktr
    pqtveivniavkeslqkkgfgkqlvldaiekakklgadtieigtgnssihqlslyqkcgf
    riqaidhdfflrhydedifengiqcrdmvrlyldllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yvkC (C:)
    klrielgeetndelydlllladpskdivdeylergecytawagdelagvyvllktrpqtv
    eivniavkeslqkkgfgkqlvldaiekakklgadtieigtgnssihqlslyqkcgfriqa
    idhdfflrhydedifengiqcrdmvrlyldll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yvkD (D:)
    mnmqklrielgeetndelydlllladpskdivdeylergecytawagdelagvyvllktr
    pqtveivniavkeslqkkgfgkqlvldaiekakklgadtieigtgnssihqlslyqkcgf
    riqaidhdfflrhydedifengiqcrdmvrlyldllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yvkD (D:)
    klrielgeetndelydlllladpskdivdeylergecytawagdelagvyvllktrpqtv
    eivniavkeslqkkgfgkqlvldaiekakklgadtieigtgnssihqlslyqkcgfriqa
    idhdfflrhydedifengiqcrdmvrlyldll