Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) |
Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
Protein Hypothetical protein Rv1347c/MT1389 [143668] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [143669] (1 PDB entry) Uniprot P64819 10-207 |
Domain d1yk3a1: 1yk3 A:10-207 [123493] complexed with bog |
PDB Entry: 1yk3 (more details), 2.2 Å
SCOPe Domain Sequences for d1yk3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} addalvrlarerfdlpdqvrrlarppvpsleppyglrvaqltdaemlaewmnrphlaaaw eydwpasrwrqhlnaqlegtyslpligswhgtdggylelywaakdlishyydadpydlgl haaiadlskvnrgfgplllprivasvfaneprcrrimfdpdhrntatrrlcewagckflg ehdttnrrmalyaleapt
Timeline for d1yk3a1: