Lineage for d1yk3d_ (1yk3 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968380Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2968547Protein Hypothetical protein Rv1347c/MT1389 [143668] (1 species)
  7. 2968548Species Mycobacterium tuberculosis [TaxId:1773] [143669] (1 PDB entry)
    Uniprot P64819 10-207
  8. 2968552Domain d1yk3d_: 1yk3 D: [123496]
    automated match to d1yk3a1
    complexed with bog

Details for d1yk3d_

PDB Entry: 1yk3 (more details), 2.2 Å

PDB Description: crystal structure of rv1347c from mycobacterium tuberculosis
PDB Compounds: (D:) Hypothetical protein Rv1347c/MT1389

SCOPe Domain Sequences for d1yk3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yk3d_ d.108.1.1 (D:) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]}
addalvrlarerfdlpdqvrrlarppvpsleppyglrvaqltdaemlaewmnrphlaaaw
eydwpasrwrqhlnaqlegtyslpligswhgtdggylelywaakdlishyydadpydlgl
haaiadlskvnrgfgplllprivasvfaneprcrrimfdpdhrntatrrlcewagckflg
ehdttnrrmalyaleaptta

SCOPe Domain Coordinates for d1yk3d_:

Click to download the PDB-style file with coordinates for d1yk3d_.
(The format of our PDB-style files is described here.)

Timeline for d1yk3d_: