PDB entry 1yk3

View 1yk3 on RCSB PDB site
Description: Crystal structure of Rv1347c from Mycobacterium tuberculosis
Class: transferase
Keywords: acyltransferase, GCN5-related fold, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC
Deposited on 2005-01-16, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.227
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein Rv1347c/MT1389
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv1347c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yk3a1
  • Chain 'B':
    Compound: Hypothetical protein Rv1347c/MT1389
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv1347c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yk3b_
  • Chain 'C':
    Compound: Hypothetical protein Rv1347c/MT1389
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv1347c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yk3c_
  • Chain 'D':
    Compound: Hypothetical protein Rv1347c/MT1389
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv1347c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yk3d_
  • Chain 'E':
    Compound: Hypothetical protein Rv1347c/MT1389
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv1347c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yk3e_
  • Chain 'F':
    Compound: Hypothetical protein Rv1347c/MT1389
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv1347c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yk3f_
  • Chain 'G':
    Compound: Hypothetical protein Rv1347c/MT1389
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv1347c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yk3g_
  • Chain 'H':
    Compound: Hypothetical protein Rv1347c/MT1389
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv1347c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yk3h_
  • Heterogens: BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yk3A (A:)
    mtkptsagqaddalvrlarerfdlpdqvrrlarppvpsleppyglrvaqltdaemlaewm
    nrphlaaaweydwpasrwrqhlnaqlegtyslpligswhgtdggylelywaakdlishyy
    dadpydlglhaaiadlskvnrgfgplllprivasvfaneprcrrimfdpdhrntatrrlc
    ewagckflgehdttnrrmalyaleapttaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yk3A (A:)
    addalvrlarerfdlpdqvrrlarppvpsleppyglrvaqltdaemlaewmnrphlaaaw
    eydwpasrwrqhlnaqlegtyslpligswhgtdggylelywaakdlishyydadpydlgl
    haaiadlskvnrgfgplllprivasvfaneprcrrimfdpdhrntatrrlcewagckflg
    ehdttnrrmalyaleapt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yk3B (B:)
    mtkptsagqaddalvrlarerfdlpdqvrrlarppvpsleppyglrvaqltdaemlaewm
    nrphlaaaweydwpasrwrqhlnaqlegtyslpligswhgtdggylelywaakdlishyy
    dadpydlglhaaiadlskvnrgfgplllprivasvfaneprcrrimfdpdhrntatrrlc
    ewagckflgehdttnrrmalyaleapttaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yk3B (B:)
    dalvrlarerfdlpdqvrrlarppvpsleppyglrvaqltdaemlaewmnrphlaaawey
    dwpasrwrqhlnaqlegtyslpligswhgtdggylelywaakdlishyydadpydlglha
    aiadlsrgfgplllprivasvfaneprcrrimfdpdhrntatrrlcewagckflgehdtt
    nrrmalyaleapt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yk3C (C:)
    mtkptsagqaddalvrlarerfdlpdqvrrlarppvpsleppyglrvaqltdaemlaewm
    nrphlaaaweydwpasrwrqhlnaqlegtyslpligswhgtdggylelywaakdlishyy
    dadpydlglhaaiadlskvnrgfgplllprivasvfaneprcrrimfdpdhrntatrrlc
    ewagckflgehdttnrrmalyaleapttaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yk3C (C:)
    ddalvrlarerfdlpdqvrrlarppvpsleppyglrvaqltdaemlaewmnrphlaaawe
    ydwpasrwrqhlnaqlegtyslpligswhgtdggylelywaakdlishyydadpydlglh
    aaiadlskvnrgfgplllprivasvfaneprcrrimfdpdhrntatrrlcewagckflge
    hdttnrrmalyaleaptta
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yk3D (D:)
    mtkptsagqaddalvrlarerfdlpdqvrrlarppvpsleppyglrvaqltdaemlaewm
    nrphlaaaweydwpasrwrqhlnaqlegtyslpligswhgtdggylelywaakdlishyy
    dadpydlglhaaiadlskvnrgfgplllprivasvfaneprcrrimfdpdhrntatrrlc
    ewagckflgehdttnrrmalyaleapttaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yk3D (D:)
    addalvrlarerfdlpdqvrrlarppvpsleppyglrvaqltdaemlaewmnrphlaaaw
    eydwpasrwrqhlnaqlegtyslpligswhgtdggylelywaakdlishyydadpydlgl
    haaiadlskvnrgfgplllprivasvfaneprcrrimfdpdhrntatrrlcewagckflg
    ehdttnrrmalyaleaptta
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1yk3E (E:)
    mtkptsagqaddalvrlarerfdlpdqvrrlarppvpsleppyglrvaqltdaemlaewm
    nrphlaaaweydwpasrwrqhlnaqlegtyslpligswhgtdggylelywaakdlishyy
    dadpydlglhaaiadlskvnrgfgplllprivasvfaneprcrrimfdpdhrntatrrlc
    ewagckflgehdttnrrmalyaleapttaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yk3E (E:)
    dalvrlarerfdlpdqvrrlarppvpsleppyglrvaqltdaemlaewmnrphlaaawey
    dwpasrwrqhlnaqlegtyslpligswhgtdggylelywaakdlishyydadpydlglha
    aiadlskvnrgfgplllprivasvfaneprcrrimfdpdhrntatrrlcewagckflgeh
    dttnrrmalyaleapt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1yk3F (F:)
    mtkptsagqaddalvrlarerfdlpdqvrrlarppvpsleppyglrvaqltdaemlaewm
    nrphlaaaweydwpasrwrqhlnaqlegtyslpligswhgtdggylelywaakdlishyy
    dadpydlglhaaiadlskvnrgfgplllprivasvfaneprcrrimfdpdhrntatrrlc
    ewagckflgehdttnrrmalyaleapttaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yk3F (F:)
    gqaddalvrlarerfdlpdqvrrlarppvpsleppyglrvaqltdaemlaewmnrphlaa
    aweydwpasrwrqhlnaqlegtyslpligswhgtdggylelywaakdlishyydadpydl
    glhaaiadlskvnrgfgplllprivasvfaneprcrrimfdpdhrntatrrlcewagckf
    lgehdttnrrmalyaleaptta
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1yk3G (G:)
    mtkptsagqaddalvrlarerfdlpdqvrrlarppvpsleppyglrvaqltdaemlaewm
    nrphlaaaweydwpasrwrqhlnaqlegtyslpligswhgtdggylelywaakdlishyy
    dadpydlglhaaiadlskvnrgfgplllprivasvfaneprcrrimfdpdhrntatrrlc
    ewagckflgehdttnrrmalyaleapttaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yk3G (G:)
    addalvrlarerfdlpdqvrrlarppvpsleppyglrvaqltdaemlaewmnrphlaaaw
    eydwpasrwrqhlnaqlegtyslpligswhgtdggylelywaakdlishyydadpydlgl
    haaiadlskvnrgfgplllprivasvfaneprcrrimfdpdhrntatrrlcewagckflg
    ehdttnrrmalyaleapttaa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1yk3H (H:)
    mtkptsagqaddalvrlarerfdlpdqvrrlarppvpsleppyglrvaqltdaemlaewm
    nrphlaaaweydwpasrwrqhlnaqlegtyslpligswhgtdggylelywaakdlishyy
    dadpydlglhaaiadlskvnrgfgplllprivasvfaneprcrrimfdpdhrntatrrlc
    ewagckflgehdttnrrmalyaleapttaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yk3H (H:)
    addalvrlarerfdlpdqvrrlarppvpsleppyglrvaqltdaemlaewmnrphlaaaw
    eydwpasrwrqhlnaqlegtyslpligswhgtdggylelywaakdlishyydadpydlgl
    haaiadlskvnrgfgplllprivasvfaneprcrrimfdpdhrntatrrlcewagckflg
    ehdttnrrmalyaleap