Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology automatically mapped to Pfam PF02776 |
Protein Acetohydroxyacid synthase catalytic subunit [88733] (3 species) |
Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142204] (12 PDB entries) Uniprot P17597 86-280 |
Domain d1ybha2: 1ybh A:86-280 [122892] Other proteins in same PDB: d1ybha1, d1ybha3 complexed with cie, fad, mg, nhe, p22 |
PDB Entry: 1ybh (more details), 2.5 Å
SCOPe Domain Sequences for d1ybha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ybha2 c.36.1.5 (A:86-280) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} tfisrfapdqprkgadilvealerqgvetvfaypggasmeihqaltrsssirnvlprheq ggvfaaegyarssgkpgiciatsgpgatnlvsgladalldsvplvaitgqvprrmigtda fqetpivevtrsitkhnylvmdvedipriieeafflatsgrpgpvlvdvpkdiqqqlaip nweqamrlpgymsrm
Timeline for d1ybha2: