SCOPe 2.08: Domain d1ybha3: 1ybh A:460-667

Lineage for d1ybha3 (1ybh A:460-667)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology

6. Protein Acetohydroxyacid synthase catalytic subunit [88758] (3 species)

7. Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142208] (12 PDB entries)
   Uniprot P17597 460-667

8. Domain d1ybha3: 1ybh A:460-667 [122893]
   Other proteins in same PDB: d1ybha1, d1ybha2
   complexed with cie, fad, mg, nhe, p22

Details for d1ybha3

PDB Entry: 1ybh, 2.5 Å

PDB Description: Crystal structure of Arabidopsis thaliana Acetohydroxyacid synthase In Complex With A Sulfonylurea Herbicide Chlorimuron Ethyl

PDB Compounds: (A:) Acetolactate synthase, chloroplast

SCOPe Domain Sequences for d1ybha3:

Sequence; same for both SEQRES and ATOM records:

>d1ybha3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}
eaippqyaikvldeltdgkaiistgvgqhqmwaaqfynykkprqwlssgglgamgfglpa
aigasvanpdaivvdidgdgsfimnvqelatirvenlpvkvlllnnqhlgmvmqwedrfy
kanrahtflgdpaqedeifpnmllfaaacgipaarvtkkadlreaiqtmldtpgpylldv
icphqehvlpmipsggtfndvitegdgr

Timeline for d1ybha3:

• d1ybha3 first appeared in SCOP 1.73
  
• d1ybha3 appears in SCOPe 2.07