Lineage for d1y71a1 (1y71 A:4-127)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.16: Kinase-associated protein B-like [141251] (1 family) 
contains extra C-terminal alpha-hairpin
automatically mapped to Pfam PF08810Family b.34.16.1: Kinase-associated protein B-like [141252] (1 protein) Protein Kinase-associated protein B [141253] (1 species) Species Bacillus cereus [TaxId:1396] [141254] (1 PDB entry)
Uniprot Q816F1 4-127
BC4909
Domain d1y71a1: 1y71 A:4-127 [122677]
Details for d1y71a1
PDB Entry: 1y71 (more details), 1.95 Å
PDB Description: x-ray crystal structure of kinase-associated protein b from bacillus cereus
PDB Compounds: (A:) Kinase-associated protein BSCOPe Domain Sequences for d1y71a1:
Sequence, based on SEQRES records: (download)
>d1y71a1 b.34.16.1 (A:4-127) Kinase-associated protein B {Bacillus cereus [TaxId: 1396]}
tfeigeivtgiyktgkyigevtnsrpgsyvvkvlavlkhpvqgdlhnvkqanvpffherr
alafreqtnipeqmvkkyegeipdyteslklaletqmnsfseddspfaersletlqqlkk
dykl
Sequence, based on observed residues (ATOM records): (download)
>d1y71a1 b.34.16.1 (A:4-127) Kinase-associated protein B {Bacillus cereus [TaxId: 1396]}
tfeigeivtgiyktgkyigevtnsrpgsyvvkvlavlkhpvqerralafreqtnipeqmv
kkyegeipdyteslklaletqmnsfseddspfaersletlqqlkkdykl
SCOPe Domain Coordinates for d1y71a1:
Click to download the PDB-style file with coordinates for d1y71a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1y71a1:
- d1y71a1 first appeared in SCOP 1.73
- d1y71a1 appears in SCOPe 2.06
- d1y71a1 appears in the current release, SCOPe 2.08
View in 3D
