Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.16: Kinase-associated protein B-like [141251] (1 family) contains extra C-terminal alpha-hairpin automatically mapped to Pfam PF08810 |
Family b.34.16.1: Kinase-associated protein B-like [141252] (1 protein) |
Protein Kinase-associated protein B [141253] (1 species) |
Species Bacillus cereus [TaxId:1396] [141254] (1 PDB entry) Uniprot Q816F1 4-127 BC4909 |
Domain d1y71a1: 1y71 A:4-127 [122677] |
PDB Entry: 1y71 (more details), 1.95 Å
SCOPe Domain Sequences for d1y71a1:
Sequence, based on SEQRES records: (download)
>d1y71a1 b.34.16.1 (A:4-127) Kinase-associated protein B {Bacillus cereus [TaxId: 1396]} tfeigeivtgiyktgkyigevtnsrpgsyvvkvlavlkhpvqgdlhnvkqanvpffherr alafreqtnipeqmvkkyegeipdyteslklaletqmnsfseddspfaersletlqqlkk dykl
>d1y71a1 b.34.16.1 (A:4-127) Kinase-associated protein B {Bacillus cereus [TaxId: 1396]} tfeigeivtgiyktgkyigevtnsrpgsyvvkvlavlkhpvqerralafreqtnipeqmv kkyegeipdyteslklaletqmnsfseddspfaersletlqqlkkdykl
Timeline for d1y71a1: