Lineage for d1y71a1 (1y71 A:4-127)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785312Superfamily b.34.16: Kinase-associated protein B-like [141251] (1 family) (S)
    contains extra C-terminal alpha-hairpin
    automatically mapped to Pfam PF08810
  5. 2785313Family b.34.16.1: Kinase-associated protein B-like [141252] (1 protein)
  6. 2785314Protein Kinase-associated protein B [141253] (1 species)
  7. 2785315Species Bacillus cereus [TaxId:1396] [141254] (1 PDB entry)
    Uniprot Q816F1 4-127
    BC4909
  8. 2785316Domain d1y71a1: 1y71 A:4-127 [122677]

Details for d1y71a1

PDB Entry: 1y71 (more details), 1.95 Å

PDB Description: x-ray crystal structure of kinase-associated protein b from bacillus cereus
PDB Compounds: (A:) Kinase-associated protein B

SCOPe Domain Sequences for d1y71a1:

Sequence, based on SEQRES records: (download)

>d1y71a1 b.34.16.1 (A:4-127) Kinase-associated protein B {Bacillus cereus [TaxId: 1396]}
tfeigeivtgiyktgkyigevtnsrpgsyvvkvlavlkhpvqgdlhnvkqanvpffherr
alafreqtnipeqmvkkyegeipdyteslklaletqmnsfseddspfaersletlqqlkk
dykl

Sequence, based on observed residues (ATOM records): (download)

>d1y71a1 b.34.16.1 (A:4-127) Kinase-associated protein B {Bacillus cereus [TaxId: 1396]}
tfeigeivtgiyktgkyigevtnsrpgsyvvkvlavlkhpvqerralafreqtnipeqmv
kkyegeipdyteslklaletqmnsfseddspfaersletlqqlkkdykl

SCOPe Domain Coordinates for d1y71a1:

Click to download the PDB-style file with coordinates for d1y71a1.
(The format of our PDB-style files is described here.)

Timeline for d1y71a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1y71b_