SCOPe 2.08: Domain d1y71b_: 1y71 B:

Lineage for d1y71b_ (1y71 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.16: Kinase-associated protein B-like [141251] (1 family)
   contains extra C-terminal alpha-hairpin
   automatically mapped to Pfam PF08810

5. Family b.34.16.1: Kinase-associated protein B-like [141252] (1 protein)

6. Protein Kinase-associated protein B [141253] (1 species)

7. Species Bacillus cereus [TaxId:1396] [141254] (1 PDB entry)
   Uniprot Q816F1 4-127
   BC4909

8. Domain d1y71b_: 1y71 B: [122678]
   automated match to d1y71a1

Details for d1y71b_

PDB Entry: 1y71, 1.95 Å

PDB Description: x-ray crystal structure of kinase-associated protein b from bacillus cereus

PDB Compounds: (B:) Kinase-associated protein B

SCOPe Domain Sequences for d1y71b_:

Sequence, based on SEQRES records:

>d1y71b_ b.34.16.1 (B:) Kinase-associated protein B {Bacillus cereus [TaxId: 1396]}
tfeigeivtgiyktgkyigevtnsrpgsyvvkvlavlkhpvqgdlhnvkqanvpffherr
alafreqtnipeqmvkkyegeipdyteslklaletqmnsfseddspfaersletlqqlkk
dykl

Sequence, based on observed residues (ATOM records):

>d1y71b_ b.34.16.1 (B:) Kinase-associated protein B {Bacillus cereus [TaxId: 1396]}
tfeigeivtgiyktgkyigevtnsrpgsyvvkvlavlkhpvqgfherralafreqtnipe
qmvkkyegeipdyteslklaletqmnsfseddspfaersletlqqlkkdykl

Timeline for d1y71b_:

• d1y71b_ first appeared in SCOP 1.73, called d1y71b1
  
• d1y71b_ appears in SCOPe 2.07