PDB entry 1y71

View 1y71 on RCSB PDB site
Description: X-ray crystal structure of kinase-associated protein B from Bacillus cereus
Class: structural genomics, unknown function
Keywords: structural genomics, kinase-associated protein B, Midwest Center for Structural Genomics, MCSG, Protein Structure Initiative, PSI, UNKNOWN FUNCTION
Deposited on 2004-12-07, released 2005-01-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinase-associated protein B
    Species: Bacillus cereus [TaxId:1396]
    Gene: BC4909
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q816F1 (Start-129)
      • modified residue (79)
      • modified residue (102)
    Domains in SCOPe 2.08: d1y71a1
  • Chain 'B':
    Compound: Kinase-associated protein B
    Species: Bacillus cereus [TaxId:1396]
    Gene: BC4909
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q816F1 (Start-129)
      • modified residue (79)
      • modified residue (102)
    Domains in SCOPe 2.08: d1y71b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y71A (A:)
    snamretfeigeivtgiyktgkyigevtnsrpgsyvvkvlavlkhpvqgdlhnvkqanvp
    ffherralafreqtnipeqmvkkyegeipdyteslklaletqmnsfseddspfaerslet
    lqqlkkdykl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y71A (A:)
    tfeigeivtgiyktgkyigevtnsrpgsyvvkvlavlkhpvqerralafreqtnipeqmv
    kkyegeipdyteslklaletqmnsfseddspfaersletlqqlkkdykl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y71B (B:)
    snamretfeigeivtgiyktgkyigevtnsrpgsyvvkvlavlkhpvqgdlhnvkqanvp
    ffherralafreqtnipeqmvkkyegeipdyteslklaletqmnsfseddspfaerslet
    lqqlkkdykl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y71B (B:)
    tfeigeivtgiyktgkyigevtnsrpgsyvvkvlavlkhpvqgfherralafreqtnipe
    qmvkkyegeipdyteslklaletqmnsfseddspfaersletlqqlkkdykl