Lineage for d1y0ua_ (1y0u A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 761989Family a.4.5.5: ArsR-like transcriptional regulators [46801] (4 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 762004Protein Putative arsenical resistance operon repressor AF0168 [116786] (1 species)
    lacks the extra C-terminal helix
  7. 762005Species Archaeoglobus fulgidus [TaxId:2234] [116787] (1 PDB entry)
    Uniprot O30069
  8. 762006Domain d1y0ua_: 1y0u A: [116310]
    Structural genomics target

Details for d1y0ua_

PDB Entry: 1y0u (more details), 1.6 Å

PDB Description: Crystal Structure of the putative arsenical resistance operon repressor from Archaeoglobus fulgidus
PDB Compounds: (A:) arsenical resistance operon repressor, putative

SCOP Domain Sequences for d1y0ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y0ua_ a.4.5.5 (A:) Putative arsenical resistance operon repressor AF0168 {Archaeoglobus fulgidus [TaxId: 2234]}
ghmsleewikadslekadeyhkrynyavtnpvrrkilrmldkgrseeeimqtlslskkql
dyhlkvleagfciervgerwvvtdagkiv

SCOP Domain Coordinates for d1y0ua_:

Click to download the PDB-style file with coordinates for d1y0ua_.
(The format of our PDB-style files is described here.)

Timeline for d1y0ua_: