![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein automated matches [190241] (12 species) not a true protein |
![]() | Species Arabidopsis thaliana [311193] (1 PDB entry) |
![]() | Domain d1xo4a_: 1xo4 A: [303366] automated match to d2evna1 |
PDB Entry: 1xo4 (more details)
SCOPe Domain Sequences for d1xo4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xo4a_ d.108.1.1 (A:) automated matches {Arabidopsis thaliana} mateppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcva afehasshsisiipscsyvsdtflprnpswkplihsevfkssi
Timeline for d1xo4a_: