PDB entry 1xo4

View 1xo4 on RCSB PDB site
Description: NMR Solution Structure of At1g77540
Class: structural genomics, unknown function
Keywords: Structural Genomics, Protein Structure Initiative, CESG, At1g77540, PSI, Center for Eukaryotic Structural Genomics
Deposited on 2004-10-05, released 2004-10-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2005-11-15, with a file datestamp of 2007-04-25.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proposed Acetyl Transferase
    Species: Arabidopsis thaliana
    Database cross-references and differences (RAF-indexed):
    • GB AAM62568 (0-102)
    Domains in SCOPe 2.06: d1xo4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xo4A (A:)
    mateppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcva
    afehasshsisiipscsyvsdtflprnpswkplihsevfkssi