Lineage for d1xc5a1 (1xc5 A:413-480)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981564Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981823Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)
  6. 1981869Protein Nuclear receptor corepressor 2 [140171] (1 species)
  7. 1981870Species Human (Homo sapiens) [TaxId:9606] [140172] (1 PDB entry)
    Uniprot Q9Y618 413-480
  8. 1981871Domain d1xc5a1: 1xc5 A:413-480 [121850]

Details for d1xc5a1

PDB Entry: 1xc5 (more details)

PDB Description: solution structure of the smrt deacetylase activation domain
PDB Compounds: (A:) Nuclear receptor corepressor 2

SCOPe Domain Sequences for d1xc5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]}
nglmadpmkvykdrqvmnmwseqeketfrekfmqhpknfgliasflerktvaecvlyyyl
tkknenyk

SCOPe Domain Coordinates for d1xc5a1:

Click to download the PDB-style file with coordinates for d1xc5a1.
(The format of our PDB-style files is described here.)

Timeline for d1xc5a1: