Lineage for d1xaka_ (1xak A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1524941Superfamily b.1.24: Accessory protein X4 (ORF8, ORF7a) [117066] (1 family) (S)
    automatically mapped to Pfam PF08779
  5. 1524942Family b.1.24.1: Accessory protein X4 (ORF8, ORF7a) [117067] (2 proteins)
  6. 1524943Protein Accessory protein X4 (ORF8, ORF7a) [117068] (1 species)
  7. 1524944Species SARS coronavirus [TaxId:227859] [117069] (1 PDB entry)
    Uniprot P59635 15-82
  8. 1524945Domain d1xaka_: 1xak A: [115037]

Details for d1xaka_

PDB Entry: 1xak (more details), 1.8 Å

PDB Description: structure of the sars-coronavirus orf7a accessory protein
PDB Compounds: (A:) sars orf7a accessory protein

SCOPe Domain Sequences for d1xaka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xaka_ b.1.24.1 (A:) Accessory protein X4 (ORF8, ORF7a) {SARS coronavirus [TaxId: 227859]}
celyhyqecvrgttvilkepcpsgtyegnspfhpladnkfaltctsthfafacadgtrht
yqlrarsv

SCOPe Domain Coordinates for d1xaka_:

Click to download the PDB-style file with coordinates for d1xaka_.
(The format of our PDB-style files is described here.)

Timeline for d1xaka_: