PDB entry 1xak

View 1xak on RCSB PDB site
Description: structure of the sars-coronavirus orf7a accessory protein
Class: Viral protein
Keywords: I-SET IG DOMAIN, BETA SANDWICH, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, Viral protein
Deposited on 2004-08-26, released 2004-10-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.223
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sars orf7a accessory protein
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59635
      • conflict (16)
    Domains in SCOPe 2.04: d1xaka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xakA (A:)
    scelyhyqecvrgttvilkepcpsgtyegnspfhpladnkfaltctsthfafacadgtrh
    tyqlrarsvspklfirqeevqqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xakA (A:)
    celyhyqecvrgttvilkepcpsgtyegnspfhpladnkfaltctsthfafacadgtrht
    yqlrarsv