Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.24: Accessory protein X4 (ORF8, ORF7a) [117066] (1 family) automatically mapped to Pfam PF08779 |
Family b.1.24.1: Accessory protein X4 (ORF8, ORF7a) [117067] (1 protein) |
Protein Accessory protein X4 (ORF8, ORF7a) [117068] (1 species) |
Species SARS coronavirus [TaxId:227859] [117069] (1 PDB entry) Uniprot P59635 15-82 |
Domain d1xaka_: 1xak A: [115037] |
PDB Entry: 1xak (more details), 1.8 Å
SCOPe Domain Sequences for d1xaka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xaka_ b.1.24.1 (A:) Accessory protein X4 (ORF8, ORF7a) {SARS coronavirus [TaxId: 227859]} celyhyqecvrgttvilkepcpsgtyegnspfhpladnkfaltctsthfafacadgtrht yqlrarsv
Timeline for d1xaka_: