Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.3: Coronavirus S2 glycoprotein [111474] (1 family) |
Family h.3.3.1: Coronavirus S2 glycoprotein [111475] (1 protein) Pfam PF01601 |
Protein E2 spike glycoprotein [111476] (2 species) |
Species Human coronavirus (strain SARS) [TaxId:227859] [111478] (9 PDB entries) Uniprot P59594 896-972,1142-1183 Uniprot Q6UZF0 914-949,1148-1193 |
Domain d1wyya1: 1wyy A:890-973,A:1147-1188 [121469] complexed with cl |
PDB Entry: 1wyy (more details), 2.2 Å
SCOPe Domain Sequences for d1wyya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wyya1 h.3.3.1 (A:890-973,A:1147-1188) E2 spike glycoprotein {Human coronavirus (strain SARS) [TaxId: 227859]} gigvtqnvlyenqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqls snfgaissvlndilsrldkveaevXlgdisginasvvniqkeidrlnevaknlneslidl qelgkye
Timeline for d1wyya1: