Lineage for d1wyya1 (1wyy A:890-973,A:1147-1188)
- Root: SCOPe 2.07
Class h: Coiled coil proteins [57942] (7 folds) 
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
core: trimeric coiled coil
Superfamily h.3.3: Coronavirus S2 glycoprotein [111474] (1 family) 
Family h.3.3.1: Coronavirus S2 glycoprotein [111475] (1 protein)
Pfam PF01601Protein E2 spike glycoprotein [111476] (2 species) Species Human coronavirus (strain SARS) [TaxId:227859] [111478] (9 PDB entries)
Uniprot P59594 896-972,1142-1183
Uniprot Q6UZF0 914-949,1148-1193
Domain d1wyya1: 1wyy A:890-973,A:1147-1188 [121469]
complexed with cl
Details for d1wyya1
PDB Entry: 1wyy (more details), 2.2 Å
PDB Description: post-fusion hairpin conformation of the sars coronavirus spike glycoprotein
PDB Compounds: (A:) e2 glycoproteinSCOPe Domain Sequences for d1wyya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wyya1 h.3.3.1 (A:890-973,A:1147-1188) E2 spike glycoprotein {Human coronavirus (strain SARS) [TaxId: 227859]}
gigvtqnvlyenqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqls
snfgaissvlndilsrldkveaevXlgdisginasvvniqkeidrlnevaknlneslidl
qelgkye
SCOPe Domain Coordinates for d1wyya1:
Click to download the PDB-style file with coordinates for d1wyya1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wyya1:
- d1wyya1 first appeared in SCOP 1.73
- d1wyya1 appears in SCOPe 2.06
- d1wyya1 appears in the current release, SCOPe 2.08
View in 3D
