SCOPe 2.08: Domain d1wyya1: 1wyy A:890-973,A:1147-1188

Lineage for d1wyya1 (1wyy A:890-973,A:1147-1188)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.3: Coronavirus S2 glycoprotein [111474] (2 families)

5. Family h.3.3.1: Coronavirus spike glycoprotein S2 fragments [111475] (1 protein)

6. Protein E2 spike glycoprotein [111476] (2 species)

7. Species Human coronavirus (strain SARS) [TaxId:227859] [111478] (9 PDB entries)
   Uniprot P59594 896-972,1142-1183
   Uniprot Q6UZF0 914-949,1148-1193

8. Domain d1wyya1: 1wyy A:890-973,A:1147-1188 [121469]
   complexed with cl

Details for d1wyya1

PDB Entry: 1wyy, 2.2 Å

PDB Description: post-fusion hairpin conformation of the sars coronavirus spike glycoprotein

PDB Compounds: (A:) e2 glycoprotein

SCOPe Domain Sequences for d1wyya1:

Sequence; same for both SEQRES and ATOM records:

>d1wyya1 h.3.3.1 (A:890-973,A:1147-1188) E2 spike glycoprotein {Human coronavirus (strain SARS) [TaxId: 227859]}
gigvtqnvlyenqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqls
snfgaissvlndilsrldkveaevXlgdisginasvvniqkeidrlnevaknlneslidl
qelgkye

Timeline for d1wyya1:

• d1wyya1 first appeared in SCOP 1.73
  
• d1wyya1 appears in SCOPe 2.07