SCOPe 2.07: Domain d1wyyb1: 1wyy B:892-973,B:1147-1188

Lineage for d1wyyb1 (1wyy B:892-973,B:1147-1188)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.3: Coronavirus S2 glycoprotein [111474] (1 family)

5. Family h.3.3.1: Coronavirus S2 glycoprotein [111475] (1 protein)
   Pfam PF01601

6. Protein E2 spike glycoprotein [111476] (2 species)

7. Species Human coronavirus (strain SARS) [TaxId:227859] [111478] (9 PDB entries)
   Uniprot P59594 896-972,1142-1183
   Uniprot Q6UZF0 914-949,1148-1193

8. Domain d1wyyb1: 1wyy B:892-973,B:1147-1188 [121470]
   automated match to d1wyya1
   complexed with cl

Details for d1wyyb1

PDB Entry: 1wyy, 2.2 Å

PDB Description: post-fusion hairpin conformation of the sars coronavirus spike glycoprotein

PDB Compounds: (B:) e2 glycoprotein

SCOPe Domain Sequences for d1wyyb1:

Sequence; same for both SEQRES and ATOM records:

>d1wyyb1 h.3.3.1 (B:892-973,B:1147-1188) E2 spike glycoprotein {Human coronavirus (strain SARS) [TaxId: 227859]}
gvtqnvlyenqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqlssn
fgaissvlndilsrldkveaevXlgdisginasvvniqkeidrlnevaknlneslidlqe
lgkye

Timeline for d1wyyb1:

• d1wyyb1 first appeared in SCOP 1.73
  
• d1wyyb1 appears in SCOPe 2.06
  
• d1wyyb1 appears in the current release, SCOPe 2.08