Class a: All alpha proteins [46456] (290 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) |
Family a.211.1.1: HD domain [101340] (15 proteins) Pfam PF01966; metal dependent phosphohydrolases |
Protein automated matches [190349] (3 species) not a true protein |
Species Escherichia coli [311188] (1 PDB entry) |
Domain d1wpha_: 1wph A: [303317] automated match to d2paqa_ |
PDB Entry: 1wph (more details), 2.1 Å
SCOPe Domain Sequences for d1wpha_:
Sequence, based on SEQRES records: (download)
>d1wpha_ a.211.1.1 (A:) automated matches {Escherichia coli} kqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvnaeri allamyhdasevltgdlptpvkyfnsqiaqeykaiekiaqqklvdmvpeelrdifaplid ehaysdeekslvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyfmei fvpsfh
>d1wpha_ a.211.1.1 (A:) automated matches {Escherichia coli} kqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvnaeri allamyhdasevltgdlptpqeykaiekiaqqklvdmvpeelrdifaplidehaysdeek slvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyfmeifvpsfh
Timeline for d1wpha_: