Lineage for d1wpha_ (1wph A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
multihelical; consists of two different alpha-helical bundlesSuperfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) 
Family a.211.1.1: HD domain [101340] (15 proteins)
Pfam PF01966; metal dependent phosphohydrolases
Protein automated matches [190349] (3 species)
not a true proteinSpecies Escherichia coli [311188] (1 PDB entry) 
Domain d1wpha_: 1wph A: [303317]
automated match to d2paqa_
Details for d1wpha_
PDB Entry: 1wph (more details), 2.1 Å
PDB Description: Structure of APC11001: Hypothetical member of the HD metal-binding phosphohydrolase superfamily
PDB Compounds: (A:) Hypothetical UPF0207 protein yfbRSCOPe Domain Sequences for d1wpha_:
Sequence, based on SEQRES records: (download)
>d1wpha_ a.211.1.1 (A:) automated matches {Escherichia coli}
kqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvnaeri
allamyhdasevltgdlptpvkyfnsqiaqeykaiekiaqqklvdmvpeelrdifaplid
ehaysdeekslvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyfmei
fvpsfh
Sequence, based on observed residues (ATOM records): (download)
>d1wpha_ a.211.1.1 (A:) automated matches {Escherichia coli}
kqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvnaeri
allamyhdasevltgdlptpqeykaiekiaqqklvdmvpeelrdifaplidehaysdeek
slvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyfmeifvpsfh
SCOPe Domain Coordinates for d1wpha_:
Click to download the PDB-style file with coordinates for d1wpha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wpha_:
- d1wpha_ first appeared in SCOPe 2.06
- d1wpha_ appears in SCOPe 2.07
View in 3D
