Lineage for d1wpha_ (1wph A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. Family a.211.1.1: HD domain [101340] (15 proteins)
    Pfam PF01966; metal dependent phosphohydrolases
  6. Protein automated matches [190349] (3 species)
    not a true protein
  7. Species Escherichia coli [311188] (1 PDB entry)
  8. Domain d1wpha_: 1wph A: [303317]
    automated match to d2paqa_

Details for d1wpha_

PDB Entry: 1wph (more details), 2.1 Å

PDB Description: Structure of APC11001: Hypothetical member of the HD metal-binding phosphohydrolase superfamily
PDB Compounds: (A:) Hypothetical UPF0207 protein yfbR

SCOPe Domain Sequences for d1wpha_:

Sequence, based on SEQRES records: (download)

>d1wpha_ a.211.1.1 (A:) automated matches {Escherichia coli}
kqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvnaeri
allamyhdasevltgdlptpvkyfnsqiaqeykaiekiaqqklvdmvpeelrdifaplid
ehaysdeekslvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyfmei
fvpsfh

Sequence, based on observed residues (ATOM records): (download)

>d1wpha_ a.211.1.1 (A:) automated matches {Escherichia coli}
kqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvnaeri
allamyhdasevltgdlptpqeykaiekiaqqklvdmvpeelrdifaplidehaysdeek
slvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyfmeifvpsfh

SCOPe Domain Coordinates for d1wpha_ are not available.

Timeline for d1wpha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wphb_