PDB entry 1wph

View 1wph on RCSB PDB site
Description: Structure of APC11001: Hypothetical member of the HD metal-binding phosphohydrolase superfamily
Class: metal binding protein
Keywords: structural genomics, MCSG, protein structure initiative, POSSIBLE HD METAL-BINDING PHOSPHOHYDROLASE, PSI, Midwest Center for Structural Genomics
Deposited on 2004-09-03, released 2004-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2007-04-10, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0207 protein yfbR
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76491
      • modified residue (23)
      • modified residue (40)
      • modified residue (67)
      • modified residue (108)
      • modified residue (176)
      • modified residue (180)
    Domains in SCOPe 2.07: d1wpha_
  • Chain 'B':
    Compound: Hypothetical UPF0207 protein yfbR
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76491
      • modified residue (23)
      • modified residue (40)
      • modified residue (67)
      • modified residue (108)
      • modified residue (176)
      • modified residue (180)
    Domains in SCOPe 2.07: d1wphb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wphA (A:)
    ghmkqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvna
    eriallamyhdasevltgdlptpvkyfnsqiaqeykaiekiaqqklvdmvpeelrdifap
    lidehaysdeekslvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyf
    meifvpsfhlsldeisqdspl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wphA (A:)
    kqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvnaeri
    allamyhdasevltgdlptpqeykaiekiaqqklvdmvpeelrdifaplidehaysdeek
    slvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyfmeifvpsfh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wphB (B:)
    ghmkqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvna
    eriallamyhdasevltgdlptpvkyfnsqiaqeykaiekiaqqklvdmvpeelrdifap
    lidehaysdeekslvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyf
    meifvpsfhlsldeisqdspl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wphB (B:)
    kqshffahlsrlklinrwplmrnvrtenvsehslqvamvahalaaiknrkfggnvnaeri
    allamyhdasevltgdlptpeykaiekiaqqklvdmvpeelrdifaplidehaysdeeks
    lvkqadalcaylkcleelaagnnefllaktrleatlearrsqemdyfmeifvpsfh