![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
![]() | Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) ![]() bind purine or pterin in topologically similar sites between subunits |
![]() | Family d.96.1.1: GTP cyclohydrolase I [55621] (2 proteins) |
![]() | Protein GTP cyclohydrolase I [55622] (4 species) beta-sheets of five subunits form a barrel, closed: n=20, S=20 |
![]() | Species Thermus thermophilus [TaxId:274] [143627] (3 PDB entries) Uniprot Q5SH52 32-216 |
![]() | Domain d1wm9a1: 1wm9 A:32-216 [121037] complexed with zn |
PDB Entry: 1wm9 (more details), 2.2 Å
SCOPe Domain Sequences for d1wm9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wm9a1 d.96.1.1 (A:32-216) GTP cyclohydrolase I {Thermus thermophilus [TaxId: 274]} evdlerlqalaaewlqvigedpgregllktpervakawafltrgyrqrleevvggavfpa egsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfarivdmfarrlqvqer lavqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqktreef lshlr
Timeline for d1wm9a1:
![]() Domains from other chains: (mouse over for more information) d1wm9b_, d1wm9c_, d1wm9d_, d1wm9e_ |