Lineage for d1wl8a1 (1wl8 A:1-188)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2467009Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2467010Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 2467124Protein GMP synthase subunit A, GuaAA [142065] (2 species)
  7. 2467125Species Pyrococcus horikoshii [TaxId:53953] [142067] (1 PDB entry)
    Uniprot O59071 1-188
  8. 2467126Domain d1wl8a1: 1wl8 A:1-188 [120997]
    complexed with acy, cl

Details for d1wl8a1

PDB Entry: 1wl8 (more details), 1.45 Å

PDB Description: Crystal structure of PH1346 protein from Pyrococcus horikoshii
PDB Compounds: (A:) GMP synthase [glutamine-hydrolyzing] subunit A

SCOPe Domain Sequences for d1wl8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wl8a1 c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA {Pyrococcus horikoshii [TaxId: 53953]}
mmivimdnggqyvhriwrtlrylgvetkiipnttpleeikamnpkgiifsggpslentgn
cekvlehydefnvpilgiclghqliakffggkvgrgekaeyslveieiidexeifkglpk
rlkvweshmdevkelppkfkilarsetcpieamkheelpiygvqfhpevahtekgeeilr
nfaklcge

SCOPe Domain Coordinates for d1wl8a1:

Click to download the PDB-style file with coordinates for d1wl8a1.
(The format of our PDB-style files is described here.)

Timeline for d1wl8a1: