Lineage for d1wl8a1 (1wl8 A:1-188)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 692818Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (8 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 692819Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (11 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 692908Protein GMP synthase subunit A, GuaAA [142065] (2 species)
  7. 692909Species Archaeon Pyrococcus horikoshii [TaxId:53953] [142067] (1 PDB entry)
  8. 692910Domain d1wl8a1: 1wl8 A:1-188 [120997]
    complexed with acy, cl, snn

Details for d1wl8a1

PDB Entry: 1wl8 (more details), 1.45 Å

PDB Description: Crystal structure of PH1346 protein from Pyrococcus horikoshii
PDB Compounds: (A:) GMP synthase [glutamine-hydrolyzing] subunit A

SCOP Domain Sequences for d1wl8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wl8a1 c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
mmivimdnggqyvhriwrtlrylgvetkiipnttpleeikamnpkgiifsggpslentgn
cekvlehydefnvpilgiclghqliakffggkvgrgekaeyslveieiidedeifkglpk
rlkvweshmdevkelppkfkilarsetcpieamkheelpiygvqfhpevahtekgeeilr
nfaklcge

SCOP Domain Coordinates for d1wl8a1:

Click to download the PDB-style file with coordinates for d1wl8a1.
(The format of our PDB-style files is described here.)

Timeline for d1wl8a1: