Lineage for d1vsga_ (1vsg A:)
- Root: SCOPe 2.08
Class h: Coiled coil proteins [57942] (7 folds) 
Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
this is not a true fold; contains at least two very long antiparallel helices
Superfamily h.4.1: Variant surface glycoprotein (N-terminal domain) [58087] (2 families) 
Family h.4.1.1: Variant surface glycoprotein (N-terminal domain) [58088] (2 proteins) Protein Variant surface glycoprotein (N-terminal domain) [58089] (1 species) Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [58090] (2 PDB entries) 
Domain d1vsga_: 1vsg A: [45782]
Details for d1vsga_
PDB Entry: 1vsg (more details), 2.9 Å
PDB Description: 2.9 angstroms resolution structure of the n-terminal domain of a variant surface glycoprotein from trypanosoma brucei
PDB Compounds: (A:) variant surface glycoprotein mitat 1.2SCOPe Domain Sequences for d1vsga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vsga_ h.4.1.1 (A:) Variant surface glycoprotein (N-terminal domain) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
aaekgfkqafwqplcqvseelddqpkgalftlqaaaskiqkmrdaalrasiyaeinhgtn
rakaavivanhyamkadsglealkqtlssqevtatatasylkgrideylnlllqtkesgt
sgcmmdtsgtntvtkaggtiggvpcklqlspiqpkrpaatylgkagyvgltrqadaannf
hdndaecrlasghntnglgksgqlsaavtmaagyvtvansqtavtvqaldalqeasgaah
qpwidawkakkaltgaetaefrnetagiagktgvtklveeallkkkdseaseiqtelkky
fsgheneqwtaiekliseqpvaqnlvgdnqptklgelegnaklttilayyrmetagkfev
lt
SCOPe Domain Coordinates for d1vsga_:
Click to download the PDB-style file with coordinates for d1vsga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vsga_:
- d1vsga_ first appeared (with stable ids) in SCOP 1.55
- d1vsga_ appears in SCOPe 2.07
View in 3D
