Lineage for d1vsga_ (1vsg A:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2646825Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 2646826Superfamily h.4.1: Variant surface glycoprotein (N-terminal domain) [58087] (2 families) (S)
  5. 2646827Family h.4.1.1: Variant surface glycoprotein (N-terminal domain) [58088] (1 protein)
  6. 2646828Protein Variant surface glycoprotein (N-terminal domain) [58089] (1 species)
  7. 2646829Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [58090] (2 PDB entries)
  8. 2646830Domain d1vsga_: 1vsg A: [45782]

Details for d1vsga_

PDB Entry: 1vsg (more details), 2.9 Å

PDB Description: 2.9 angstroms resolution structure of the n-terminal domain of a variant surface glycoprotein from trypanosoma brucei
PDB Compounds: (A:) variant surface glycoprotein mitat 1.2

SCOPe Domain Sequences for d1vsga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsga_ h.4.1.1 (A:) Variant surface glycoprotein (N-terminal domain) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
aaekgfkqafwqplcqvseelddqpkgalftlqaaaskiqkmrdaalrasiyaeinhgtn
rakaavivanhyamkadsglealkqtlssqevtatatasylkgrideylnlllqtkesgt
sgcmmdtsgtntvtkaggtiggvpcklqlspiqpkrpaatylgkagyvgltrqadaannf
hdndaecrlasghntnglgksgqlsaavtmaagyvtvansqtavtvqaldalqeasgaah
qpwidawkakkaltgaetaefrnetagiagktgvtklveeallkkkdseaseiqtelkky
fsgheneqwtaiekliseqpvaqnlvgdnqptklgelegnaklttilayyrmetagkfev
lt

SCOPe Domain Coordinates for d1vsga_:

Click to download the PDB-style file with coordinates for d1vsga_.
(The format of our PDB-style files is described here.)

Timeline for d1vsga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vsgb_