PDB entry 1vsg

View 1vsg on RCSB PDB site
Description: 2.9 angstroms resolution structure of the n-terminal domain of a variant surface glycoprotein from trypanosoma brucei
Class: glycoprotein
Keywords: glycoprotein
Deposited on 1990-10-22, released 1992-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.22
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: variant surface glycoprotein mitat 1.2
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vsga_
  • Chain 'B':
    Compound: variant surface glycoprotein mitat 1.2
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vsgb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vsgA (A:)
    aaekgfkqafwqplcqvseelddqpkgalftlqaaaskiqkmrdaalrasiyaeinhgtn
    rakaavivanhyamkadsglealkqtlssqevtatatasylkgrideylnlllqtkesgt
    sgcmmdtsgtntvtkaggtiggvpcklqlspiqpkrpaatylgkagyvgltrqadaannf
    hdndaecrlasghntnglgksgqlsaavtmaagyvtvansqtavtvqaldalqeasgaah
    qpwidawkakkaltgaetaefrnetagiagktgvtklveeallkkkdseaseiqtelkky
    fsgheneqwtaiekliseqpvaqnlvgdnqptklgelegnaklttilayyrmetagkfev
    ltqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vsgA (A:)
    aaekgfkqafwqplcqvseelddqpkgalftlqaaaskiqkmrdaalrasiyaeinhgtn
    rakaavivanhyamkadsglealkqtlssqevtatatasylkgrideylnlllqtkesgt
    sgcmmdtsgtntvtkaggtiggvpcklqlspiqpkrpaatylgkagyvgltrqadaannf
    hdndaecrlasghntnglgksgqlsaavtmaagyvtvansqtavtvqaldalqeasgaah
    qpwidawkakkaltgaetaefrnetagiagktgvtklveeallkkkdseaseiqtelkky
    fsgheneqwtaiekliseqpvaqnlvgdnqptklgelegnaklttilayyrmetagkfev
    lt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vsgB (B:)
    aaekgfkqafwqplcqvseelddqpkgalftlqaaaskiqkmrdaalrasiyaeinhgtn
    rakaavivanhyamkadsglealkqtlssqevtatatasylkgrideylnlllqtkesgt
    sgcmmdtsgtntvtkaggtiggvpcklqlspiqpkrpaatylgkagyvgltrqadaannf
    hdndaecrlasghntnglgksgqlsaavtmaagyvtvansqtavtvqaldalqeasgaah
    qpwidawkakkaltgaetaefrnetagiagktgvtklveeallkkkdseaseiqtelkky
    fsgheneqwtaiekliseqpvaqnlvgdnqptklgelegnaklttilayyrmetagkfev
    ltqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vsgB (B:)
    aaekgfkqafwqplcqvseelddqpkgalftlqaaaskiqkmrdaalrasiyaeinhgtn
    rakaavivanhyamkadsglealkqtlssqevtatatasylkgrideylnlllqtkesgt
    sgcmmdtsgtntvtkaggtiggvpcklqlspiqpkrpaatylgkagyvgltrqadaannf
    hdndaecrlasghntnglgksgqlsaavtmaagyvtvansqtavtvqaldalqeasgaah
    qpwidawkakkaltgaetaefrnetagiagktgvtklveeallkkkdseaseiqtelkky
    fsgheneqwtaiekliseqpvaqnlvgdnqptklgelegnaklttilayyrmetagkfev
    lt