Lineage for d1vlga_ (1vlg A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766020Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 766587Protein Non-hem ferritin [63524] (4 species)
  7. 766622Species Thermotoga maritima [TaxId:2336] [109783] (1 PDB entry)
    Uniprot Q9X0L2
  8. 766623Domain d1vlga_: 1vlg A: [108816]
    Structural genomics target

Details for d1vlga_

PDB Entry: 1vlg (more details), 2 Å

PDB Description: crystal structure of ferritin (tm1128) from thermotoga maritima at 2.00 a resolution
PDB Compounds: (A:) Ferritin

SCOP Domain Sequences for d1vlga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlga_ a.25.1.1 (A:) Non-hem ferritin {Thermotoga maritima [TaxId: 2336]}
mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre

SCOP Domain Coordinates for d1vlga_:

Click to download the PDB-style file with coordinates for d1vlga_.
(The format of our PDB-style files is described here.)

Timeline for d1vlga_: