Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.2: YihX-like [56789] (3 proteins) the insertion subdomain is a 4-helical bundle automatically mapped to Pfam PF13419 |
Protein Epoxide hydrolase, N-terminal domain [56790] (2 species) has a lipid phosphatase activity |
Species Human (Homo sapiens) [TaxId:9606] [102303] (36 PDB entries) |
Domain d1vj5a1: 1vj5 A:2-225 [100799] Other proteins in same PDB: d1vj5a2 complexed with ciu, mg, p6g, po4 |
PDB Entry: 1vj5 (more details), 2.35 Å
SCOPe Domain Sequences for d1vj5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vj5a1 c.108.1.2 (A:2-225) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} tlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitls qwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttai ltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevv flddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpap
Timeline for d1vj5a1: