PDB entry 1vj5

View 1vj5 on RCSB PDB site
Description: Human soluble Epoxide Hydrolase- N-cyclohexyl-N'-(4-iodophenyl)urea complex
Class: hydrolase
Keywords: domain-swapped dimer, HYDROLASE
Deposited on 2004-02-03, released 2004-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.217
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epoxide hydrolase 2, cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHX2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vj5a1, d1vj5a2
  • Heterogens: MG, PO4, P6G, CIU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vj5A (A:)
    mtlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitl
    sqwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgftta
    iltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsev
    vflddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpaplptscnpsdmshg
    yvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvlamdmkgygess
    appeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervravaslnt
    pfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslfrasdesvlsmh
    kvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnmernwkwacksl
    grkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmdkptevnqilik
    wldsdarnppvvskm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vj5A (A:)
    tlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitls
    qwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttai
    ltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevv
    flddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpaplptscnpsdmshgy
    vtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvlamdmkgygessa
    ppeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervravaslntp
    fipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslfrasdesvlsmhk
    vceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnmernwkwackslg
    rkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmdkptevnqilikw
    ldsdarn