SCOPe 2.08: Domain d1vj5a2: 1vj5 A:226-547

Lineage for d1vj5a2 (1vj5 A:226-547)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins)

6. Protein Mammalian epoxide hydrolase, C-terminal domain [53526] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102626] (49 PDB entries)

8. Domain d1vj5a2: 1vj5 A:226-547 [100800]
   Other proteins in same PDB: d1vj5a1
   complexed with ciu, mg, p6g, po4

Details for d1vj5a2

PDB Entry: 1vj5, 2.35 Å

PDB Description: human soluble epoxide hydrolase- n-cyclohexyl-n'-(4-iodophenyl)urea complex

PDB Compounds: (A:) epoxide hydrolase 2, cytoplasmic

SCOPe Domain Sequences for d1vj5a2:

Sequence; same for both SEQRES and ATOM records:

>d1vj5a2 c.69.1.11 (A:226-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
lptscnpsdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyr
vlamdmkgygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalf
ypervravaslntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfks
lfrasdesvlsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyr
nmernwkwackslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtq
mdkptevnqilikwldsdarn

Timeline for d1vj5a2:

• d1vj5a2 first appeared in SCOP 1.67
  
• d1vj5a2 appears in SCOPe 2.07