SCOP 1.67: Domain d1vj5a1: 1vj5 A:2-225

Lineage for d1vj5a1 (1vj5 A:2-225)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (14 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.2: Epoxide hydrolase, N-terminal domain [56789] (1 protein)
   the insertion subdomain is a 4-helical bundle

6. Protein Epoxide hydrolase, N-terminal domain [56790] (2 species)
   has a lipid phosphatase activity

7. Species Human (Homo sapiens) [TaxId:9606] [102303] (2 PDB entries)

8. Domain d1vj5a1: 1vj5 A:2-225 [100799]
   Other proteins in same PDB: d1vj5a2
   complexed with ciu, mg, p6g, po4

Details for d1vj5a1

PDB Entry: 1vj5, 2.35 Å

PDB Description: human soluble epoxide hydrolase- n-cyclohexyl-n'-(4-iodophenyl)urea complex

SCOP Domain Sequences for d1vj5a1:

Sequence; same for both SEQRES and ATOM records:

>d1vj5a1 c.108.1.2 (A:2-225) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens)}
tlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitls
qwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttai
ltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevv
flddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpap

Timeline for d1vj5a1:

• d1vj5a1 is new in SCOP 1.67
  
• d1vj5a1 appears in SCOP 1.69
  
• d1vj5a1 appears in the current release, SCOPe 2.08