Lineage for d1vj5a1 (1vj5 A:2-225)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 404418Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 404419Superfamily c.108.1: HAD-like [56784] (14 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 404436Family c.108.1.2: Epoxide hydrolase, N-terminal domain [56789] (1 protein)
    the insertion subdomain is a 4-helical bundle
  6. 404437Protein Epoxide hydrolase, N-terminal domain [56790] (2 species)
    has a lipid phosphatase activity
  7. 404438Species Human (Homo sapiens) [TaxId:9606] [102303] (2 PDB entries)
  8. 404439Domain d1vj5a1: 1vj5 A:2-225 [100799]
    Other proteins in same PDB: d1vj5a2
    complexed with ciu, mg, p6g, po4

Details for d1vj5a1

PDB Entry: 1vj5 (more details), 2.35 Å

PDB Description: human soluble epoxide hydrolase- n-cyclohexyl-n'-(4-iodophenyl)urea complex

SCOP Domain Sequences for d1vj5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vj5a1 c.108.1.2 (A:2-225) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens)}
tlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitls
qwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttai
ltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevv
flddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpap

SCOP Domain Coordinates for d1vj5a1:

Click to download the PDB-style file with coordinates for d1vj5a1.
(The format of our PDB-style files is described here.)

Timeline for d1vj5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vj5a2