![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
![]() | Protein Deoxyribose-phosphate aldolase DeoC [69394] (6 species) |
![]() | Species Pyrobaculum aerophilum [TaxId:13773] [141830] (1 PDB entry) Uniprot Q8ZXK7 1-226 |
![]() | Domain d1vcva1: 1vcv A:1-226 [119988] Other proteins in same PDB: d1vcvb_ complexed with zn |
PDB Entry: 1vcv (more details), 2 Å
SCOPe Domain Sequences for d1vcva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vcva1 c.1.10.1 (A:1-226) Deoxyribose-phosphate aldolase DeoC {Pyrobaculum aerophilum [TaxId: 13773]} mihlvdyallkpyltvdeavagarkaeelgvaaycvnpiyapvvrpllrkvklcvvadfp fgalptasrialvsrlaevadeidvvapiglvksrrwaevrrdlisvvgaaggrvvkvit eepylrdeerytlydiiaeagahfiksstgfaeeayaarqgnpvhstperaaaiaryike kgyrlgvkmaggirtreqakaivdaigwgedparvrlgtstpeall
Timeline for d1vcva1: