Lineage for d1vcva1 (1vcv A:1-226)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834502Protein Deoxyribose-phosphate aldolase DeoC [69394] (6 species)
  7. 2834518Species Pyrobaculum aerophilum [TaxId:13773] [141830] (1 PDB entry)
    Uniprot Q8ZXK7 1-226
  8. 2834519Domain d1vcva1: 1vcv A:1-226 [119988]
    Other proteins in same PDB: d1vcvb_
    complexed with zn

Details for d1vcva1

PDB Entry: 1vcv (more details), 2 Å

PDB Description: Structure of 2-deoxyribose-5-phosphate aldolase from Pyrobaculum aerophilum
PDB Compounds: (A:) Probable deoxyribose-phosphate aldolase

SCOPe Domain Sequences for d1vcva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vcva1 c.1.10.1 (A:1-226) Deoxyribose-phosphate aldolase DeoC {Pyrobaculum aerophilum [TaxId: 13773]}
mihlvdyallkpyltvdeavagarkaeelgvaaycvnpiyapvvrpllrkvklcvvadfp
fgalptasrialvsrlaevadeidvvapiglvksrrwaevrrdlisvvgaaggrvvkvit
eepylrdeerytlydiiaeagahfiksstgfaeeayaarqgnpvhstperaaaiaryike
kgyrlgvkmaggirtreqakaivdaigwgedparvrlgtstpeall

SCOPe Domain Coordinates for d1vcva1:

Click to download the PDB-style file with coordinates for d1vcva1.
(The format of our PDB-style files is described here.)

Timeline for d1vcva1: