| Class b: All beta proteins [48724] (174 folds) |
| Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) ![]() two constituent families are related by circular permutation |
| Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins) topologically similar to the C-terminal domain of PapD |
| Protein Regulating synaptic membrane exocytosis protein, rim2 [101564] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [101565] (1 PDB entry) |
| Domain d1v27a_: 1v27 A: [100262] first C2 domain |
PDB Entry: 1v27 (more details)
SCOPe Domain Sequences for d1v27a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v27a_ b.7.1.2 (A:) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]}
gssgssggqlsiklwfdkvghqlivtilgakdlpsredgrprnpyvkiyflpdrsdknkr
rtktvkktlepkwnqtfiyspvhrrefrermleitlwdqarvreeeseflgeilieleta
llddephwyklqthdsgpssg
Timeline for d1v27a_: