Lineage for d1v27a_ (1v27 A:)
- Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds) 
Fold b.7: C2 domain-like [49561] (4 superfamilies)
sandwich; 8 strands in 2 sheets; greek-key
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) 
two constituent families are related by circular permutation
Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (7 proteins)
topologically similar to the C-terminal domain of PapD
Protein Regulating synaptic membrane exocytosis protein, rim2 [101564] (1 species) Species Human (Homo sapiens) [TaxId:9606] [101565] (1 PDB entry) 
Domain d1v27a_: 1v27 A: [100262]
first C2 domain
Details for d1v27a_
PDB Entry: 1v27 (more details)
PDB Description: solution structure of the first c2 domain of rim2
SCOP Domain Sequences for d1v27a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v27a_ b.7.1.2 (A:) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens)}
gssgssggqlsiklwfdkvghqlivtilgakdlpsredgrprnpyvkiyflpdrsdknkr
rtktvkktlepkwnqtfiyspvhrrefrermleitlwdqarvreeeseflgeilieleta
llddephwyklqthdsgpssg
SCOP Domain Coordinates for d1v27a_:
Click to download the PDB-style file with coordinates for d1v27a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1v27a_:
- d1v27a_ is new in SCOP 1.67
- d1v27a_ appears in SCOP 1.69
- d1v27a_ appears in the current release, SCOPe 2.08, called d1v27a1
View in 3D