![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins) topologically similar to the C-terminal domain of PapD |
![]() | Protein Regulating synaptic membrane exocytosis protein, rim2 [101564] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101565] (1 PDB entry) |
![]() | Domain d1v27a1: 1v27 A:8-135 [100262] Other proteins in same PDB: d1v27a2, d1v27a3 first C2 domain |
PDB Entry: 1v27 (more details)
SCOPe Domain Sequences for d1v27a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v27a1 b.7.1.2 (A:8-135) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} gqlsiklwfdkvghqlivtilgakdlpsredgrprnpyvkiyflpdrsdknkrrtktvkk tlepkwnqtfiyspvhrrefrermleitlwdqarvreeeseflgeilieletallddeph wyklqthd
Timeline for d1v27a1: