Class a: All alpha proteins [46456] (290 folds) |
Fold a.207: Formin homology 2 domain (FH2 domain) [101446] (1 superfamily) multihelical, consists of three all-alpha domains |
Superfamily a.207.1: Formin homology 2 domain (FH2 domain) [101447] (1 family) automatically mapped to Pfam PF02181 |
Family a.207.1.1: Formin homology 2 domain (FH2 domain) [101448] (2 proteins) |
Protein Bni1 [101451] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101452] (3 PDB entries) |
Domain d1ux4a_: 1ux4 A: [100142] |
PDB Entry: 1ux4 (more details), 3.3 Å
SCOPe Domain Sequences for d1ux4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ux4a_ a.207.1.1 (A:) Bni1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} prphkklkqlhwekldctdnsiwgtgkaekfaddlyekgvladlekafaareikslaske fkitflsrdisqqfginlhmysslsvadlvkkilncdrdflqtpsvveflskseiievsv nlarnyapystdwegvrnledakppekdpndlqradqiylqlmvnlesywgsrmraltvv tsyereynellaklrkvdkavsalqesdnlrnvfnvilavgnfmndtskqaqgfklstlq rltfikdttnsmtflnyvekivrlnypsfndflselepvldvvkvsieqlvndckdfsqs ivnversveignlsdsskfhpldkvliktlpvlpearkkgdlledevkltimefeslmht ygedsgdkfakisffkkfadfineykkaqaqnlaaeeeerlyikhkkive
Timeline for d1ux4a_: