PDB entry 1ux4

View 1ux4 on RCSB PDB site
Description: crystal structures of a formin homology-2 domain reveal a tethered-dimer architecture
Class: structural protein
Keywords: structural protein, fh2 actin cytoskeleton, coiled coil
Deposited on 2004-02-19, released 2004-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.234
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bni1 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41832
      • engineered mutation (59-60)
    Domains in SCOPe 2.07: d1ux4a_
  • Chain 'B':
    Compound: bni1 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41832 (61-409)
      • engineered mutation (59-60)
    Domains in SCOPe 2.07: d1ux4b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ux4A (A:)
    prphkklkqlhwekldctdnsiwgtgkaekfaddlyekgvladlekafaareikslaske
    fkitflsrdisqqfginlhmysslsvadlvkkilncdrdflqtpsvveflskseiievsv
    nlarnyapystdwegvrnledakppekdpndlqradqiylqlmvnlesywgsrmraltvv
    tsyereynellaklrkvdkavsalqesdnlrnvfnvilavgnfmndtskqaqgfklstlq
    rltfikdttnsmtflnyvekivrlnypsfndflselepvldvvkvsieqlvndckdfsqs
    ivnversveignlsdsskfhpldkvliktlpvlpearkkgdlledevkltimefeslmht
    ygedsgdkfakisffkkfadfineykkaqaqnlaaeeeerlyikhkkive
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ux4B (B:)
    prphkklkqlhwekldctdnsiwgtgkaekfaddlyekgvladlekafaareikslaske
    fkitflsrdisqqfginlhmysslsvadlvkkilncdrdflqtpsvveflskseiievsv
    nlarnyapystdwegvrnledakppekdpndlqradqiylqlmvnlesywgsrmraltvv
    tsyereynellaklrkvdkavsalqesdnlrnvfnvilavgnfmndtskqaqgfklstlq
    rltfikdttnsmtflnyvekivrlnypsfndflselepvldvvkvsieqlvndckdfsqs
    ivnversveignlsdsskfhpldkvliktlpvlpearkkgdlledevkltimefeslmht
    ygedsgdkfakisffkkfadfineykkaqaqnlaaeeeerlyikhkkive